Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5jneA_

Fold library idPDB HeaderMoleculeTitle
c5jneA_2.85PDB header: ligase/signaling proteinChain: A: PDB Molecule: e3 sumo-protein ligase siz1,ubiquitin-like protein smt3;


Added to library: Thu Feb 9 12:37:08 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PTIHFKESPFYKIQRLIPELVMNVEVTGGRGMCSAKFKLSKADYNLLSNPNSKHRLYLFSGMINPLGSRG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)



B

BTT




STT



TT


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence NEPIQFPFPNELRCNNVQIKDNIRGFKSKPGTAKPADLTPHLKPYTQQNNVELIYAFTTKEYKLFGYIVE
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) SB




SSTT







SSSTT




GGG


TTS
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence MITPEQLLEKVLQHPKIIKQATLLYLKKTLREDEEMGLTTTSTIMSLQDPISYTRMKYPSKSINCKHLQC
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

S

B
TT





B
TTT
SB
SSTT

SS

 .........220.........230.........240.........250.........260.........270.........280
Sequence FDALWFLHSQLQIPTWQCPVCQIDIALENLAISEFVDDILQNCQKNVEQVELTSDGKWTAILDKLRPETH
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S


B
TTT

B

GGGBTS
TT


TTS







TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence INLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHR
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)
SS
SSS
TTT

GGG
TT

TT

TTTTT

TT
 .
Sequence E
Predicted secondary structure
SS confidence
Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D