Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5jkjA_

Fold library idPDB HeaderMoleculeTitle
c5jkjA_1.55PDB header: hydrolaseChain: A: PDB Molecule: esterase e22;


Added to library: Sat Apr 29 08:52:15 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MVEKRVFEMPHFTTFGGKQIKNVKVGWEAYGTLNDAKSNVILITHYFSGSSHAAGKYDENDPAPGYWDSI
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)




TTS
S


TT





TT

S

SS
SSTT
SS

TTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence IGPGKAIDTDRFYVISVDTLANLNAYDPHVITTGPTSINPDTGKPYGLDFPVVTIRDFVNVQKALLESLG
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) TTSSTTT


TT
S
TT
SS



STTSTTTT
GGGS



TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence ISKLYAVIGPSMGSMQAIDWASAYPGWVERMISVIGAGQSDAWTTAALEHWATPITLDKNWNNGAYSKEQ
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


BSTSGGGBSS

SB

SGGGGGGT

GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence APLNGLAASLMLITQNALTPSFFNQTGNTLGYKNVESAPLNDIRQSHSIVNWLRERAKTRAKSMDANHLL
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)

TS
T

SS

TTS

TT

 .........290.........300.........310.........320.........330.........340.........350
Sequence YLVRACQLFVAGHQGNLEQGLASIKAKTLFIPAQTDLLLMPYLSQSAHQGLTSMNNDSTLVTLNGKLGHD
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) T
BGGGSSST

S
BTT
SSS
TT



B

TTGGG
 .........360.........370
Sequence EGVTNVSAQAQAIRQFLEND
Predicted secondary structure



SS confidence



















Known secondary structure (DSSP)
GGGG



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D