Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5jjtA_

Fold library idPDB HeaderMoleculeTitle
c5jjtA_2.10PDB header: hydrolaseChain: A: PDB Molecule: serine/threonine-protein phosphatase 5;


Added to library: Sat Apr 29 10:22:34 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VSRAEEFKSQANEAFKGHKYSSAIDLYTKAIELNSNNAVYWANRAFAHTKLEEYGSAIQDASKAIEVDSR
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)

TT

TT
TT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence YSKGYYRRGAAYLAMGKFKDALKDFQQVKRLSPNATRKLKECEKAVMKLKFEEAISVPVSERRSVAESID
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)
TT




T


GGGS

GGGT

 .........150.........160.........170.........180.........190.........200.........210
Sequence FHTIEVEPQYSGARIEGEEVTLDFVKTMMEDFKNQKTLHKRYAYQIVLQTRQILLALPSLVDISVPHGKH
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) GGG



TT

S



SSS

TT



TS
S


TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence ITVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEIILTLFAFKCMCPSSIYLARGNHES
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


TT



BTTB
S

SSSSS

GGG

TTSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence KSMNKIYGFEGEVRSKLSEKFVDLFAEVFCYLPLAHVINGKVFVVHGGLFSVDGVKLSDIRAIDRFCEPP
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SS
TTS
STTTSS


SSS


T



S


 .........360.........370.........380.........390.........400.........410.........420
Sequence EEGLMCELLWSDPQPLPGRGPSKRGVGLSFGGDVTKRFLQDNNLDLLVRSHEVKDEGYEVEHDGKLITVF
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SSS

SSSS
TTSSS
TT
S
SS

TTSTTTT
 .........430.........440.........450.........460.........470.
Sequence SAPNYCDQMGNKGAFIRFEAPDMKPNIVTFSAVPHPDVKPMAYANNFLRMF
Predicted secondary structure




























SS confidence


















































Known secondary structure (DSSP)

TTGGGTS


TTT







S

TTTTS
T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D