Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5jirB_

Fold library idPDB HeaderMoleculeTitle
c5jirB_1.70PDB header: unknown functionChain: B: PDB Molecule: oop family ompa-ompf porin;


Added to library: Thu Feb 9 13:27:11 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DAVHTDAVQDWKNGTINAQLTLDLARARMRLPADRTAASQFLRYKAPAQLKDVYLSVLVDSQNRVGDCLA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

TTTTTTTTT

TTTTTSB
SSS
B
 .........80.........90.........100.........110.........120.........130.........140
Sequence HEKIRLADITALVDAGHHAVTTLSPSVRSLQLSHQTPLTALARLFVTHETAYVSRPYTGILIDARGSLPV
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) TTSS
TT


TTS
S
SSSSSGGG


SS






S

S
B
 .........150.........160.........170.........180.........190.........200.........210
Sequence HGEYVSEPLSACLFPKIWSTDMDLIYEKNMVHPDRAKAWGVVRYGSVWDEKMYRDRIGTTPLKIIARGVF
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTSS





SS

TT


GGGS

S

GGG




SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence GQQRTDPIIASKDAAQILARPENLRLLAEGNVIILCDEAALRVHVPYPLVDEHFYFAYHDVKRFLTDERS
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTTT

T
T




SS


T
 .........290.........300.........310.........320.........330.........340.........350
Sequence PGVGVRSGINTLKITVYDVRFVANSPEILASEKDRVDVIATALKKMGPYTRFLIEGHTADLHRPQEEAAL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT
SS
S



TTS
S

TT
SS




S
 .........360.........370.........380.........390.........400.....
Sequence SVARAQRMAQELSRRGIEMTRITTAGHGATKPIAPSDTHANKAKNRRVEITILRD
Predicted secondary structure



















SS confidence






















































Known secondary structure (DSSP) TTT

GGG
TTSS
SS
SSSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D