Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5jheA_

Fold library idPDB HeaderMoleculeTitle
c5jheA_1.80PDB header: chaperoneChain: A: PDB Molecule: peptidyl-prolyl cis-trans isomerase cyp7;


Added to library: Sat Apr 29 08:55:49 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HHHMMIQDPLVYLDISIDKKPIGRIVCKLFREKAPKTTENFYKLCAGDVKSPLKDQQYLSYKGNGFHRVV
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)








TT
TTT
T

SSSTT


TT
B
 .........80.........90.........100.........110.........120.........130.........140
Sequence KNFMIQAGDIVFGTQKDSSSVGKGGCSIYADKEEVKTDDESFCYGNFEDENLGEFVEPFTLGMANLGSPN
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP) TTT

TTTSSS


TTTTS

TT


SS

S
B








SSS

SSSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence TNNSQFFITTYAAPHLNGKHSIFGQVVHGKSVVRTIENCRVDSDGVPESDVRISDCGVWEKTMGVPLYNA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)
BSS
SS

GGGTTTS

TS
B
TTS
BSS


GGG


BSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence SNDQIGGDVYEEYPDDDTHFGDDDFGKALEAANIIKESGTLLFKKKDYSNAFFKYRKSLNYINEYMPEPD
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)



GGG

S
SSGGG

SS
TT
TT



TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence VDKERNIQFINLKMKIYLNLSLVLFNLERYDDAIMYATYLLEMDNVPNRDQAKAYYRRGNSYLKKKRLDE
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) T
TT
TSTT

TT
 .........360.........370.........380........
Sequence ALQDYIFCKEKNPDDEVIEQRIEYVNRLIEENKEKTRK
Predicted secondary structure





SS confidence





































Known secondary structure (DSSP)
SS
SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D