Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5jh5A_

Fold library idPDB HeaderMoleculeTitle
c5jh5A_2.55PDB header: metal binding protein/transcriptionChain: A: PDB Molecule: lysine-specific demethylase 2b;


Added to library: Thu Feb 9 12:21:51 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XHREVWXAVFSYLSHQDLCVCXRVCRTWNRWCCDKRLWTRIDLNHCKSITPLXLSGIIRRQPVSLDLSWT
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

TTS
TT
TTTT
GGGGS
TT






S
TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence NISKKQLSWLINRLPGLRDLVLSGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQXRDLLSPPTDNRPN
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP)



TT


TT
BGGGGSSS



S
TT
BT
BS







 .........150.........160.........170.........180.........190.........200.........210
Sequence RSKLRNIVELRLAGLDITDASLRLIIRHXPLLSKLHLSYCNHVTDQSINLLTAVGTTTRDSLTEINLSDC
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)

TTTT


TT
B


TT


TT
TT

T
TT



TT
 .........220.........230.........240.........250.........260.......
Sequence NKVTDQCLSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEXSVSVQFGQVEEKLLQKL
Predicted secondary structure




























SS confidence
























































Known secondary structure (DSSP) TT

TTT
SS


TT
TT

TTT


SSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D