Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5jbfB_

Fold library idPDB HeaderMoleculeTitle
c5jbfB_2.19PDB header: transferaseChain: B: PDB Molecule: inactive glucansucrase;


Added to library: Thu Feb 9 17:07:51 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MGPGTWENMAFAQDSSAINNIDGYLSYTDWYRPYGTSQDGKTWYKTTAMDWRPLLMYIWPSKDVQAQFIK
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)

SSGGGGSBSSSSTTTB

BTTB
BTT

BS
SSSS



TT

GGGT

SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence YFVNNGYENANYGLTKDTVANINKDTNTTVLANMAQNLRYVIEQSIAANKGTSKLANDINSFAATVPELS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TT

BGGGTBBTT

TTS
TTSSTSGGGS
 .........150.........160.........170.........180.........190.........200.........210
Sequence ASSELSLQSMPNYRPDKSGTIDSDQVIFVNNNSKDPRKGNTSYADSNYRLMNRTINNQAGNNNSDNSPEL
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP) GGGG

GGGSTT



TTSS
TT







TTT


GGG

S






GGGTTSS

SS


S
 .........220.........230.........240.........250.........260.........270.........280
Sequence LVGNDIDNSNPVVQAENLNWEYFLLNYGKLMGYNPDGNFDGFRVNAADNIDADVLDQMGQLMNDMYHTKG
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
SS
TTSTTS
TT



TTTTSS
T

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence NPQNANDHLSYNEGYHSGAAQMLNEKGNPQLYMDSGEFYTLENVLGRANNRDNIGNLITNSIVNRQNDTT
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
T



S
TTT
SSB
TT
SSS


TTSSSS

S

 .........360.........370.........380.........390.........400.........410.........420
Sequence ENEATPNWSFVTNHDQRKNLINRLIIKDHSNIPDIMGSAYKVEYANQAWQEFYADQEKTNKQYAQYNVPA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) SS
S

S

TTTSTTTTTTT

TSSS
SSS
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence QYAILLSNKDTVPQVYYGDLYNETAQYMQEKSIYYDAITTLMRARKQFVSGGQTMTKLNNNLLASVRYGK
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
SSSB
TTSSTTSSB
TT

S
TT

T
 .........500.........510.........520.........530.........540.........550.........560
Sequence GVVDANSNGTDKLSRTSGMAVLVGNDSNMAQQSVAINMGRAHANQQYRNLIDTTENGLTYDADNSENPAI
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) T

STT


SSTTSTT



TT




GGGTT

SSSSS

SSSS
S
 .........570.........580.........590.........600.........610.........620.........630
Sequence LTTDSNGILKVTVKGYSNPYVSGYLGVWVPVISGDQDVTTNASDVVANKEKTFESNAALDSHMIYEDFSL
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

TTS

SSS


SS






GGGS


TT
SS

ST




T
 .........640.........650.........660.........670.........680.........690.........700
Sequence FQPEPTSVENHAYNVIAKNASLFSDLGITDFWMAPAYTPFGRSRYNEGYSMTDRYNLGTTANPTKYGSGE
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) T



SSSTTSTTT




S
TTSSS
SSSSSS



SSS

SS

 .........710.........720.........730.........740.........750.........760.........770
Sequence ELANTIAALHKAGLKVQEDIVMNQMIGFSGQEAVTVTRTNNRGMQIHVNGQTYANQIYFAYTTGGGNGQE
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT


S




TTS
B

BTTB


SB
 .........780.........790.........800.........810.........820.........830.........840
Sequence TYGGKYLAELQKNYPDLFTTKAISTGVAPDPTVRINKWSAKYQNGTSLQNIGIGLAVKLANGDYAYLNSG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTTT
GGGGTS

TTTSS


TTS

SSB
GGG

SS
S

B
B
TTS
B
B

BT
 .........850....
Sequence DNKAFNTLLPTAIS
Predicted secondary structure













SS confidence













Known secondary structure (DSSP) TB
SS

B

GGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D