Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ja2A_

Fold library idPDB HeaderMoleculeTitle
c5ja2A_3.00PDB header: ligaseChain: A: PDB Molecule: enterobactin synthase component f;


Added to library: Fri Feb 10 12:19:43 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EKLSELPSAWSVAHYVELTGEVDSPLLARAVVAGLAQADTLRMRFTEVWQWVDDALTFELPEIIDLRTNI
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


SS








SSSS




TT






TTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence DPHGTAQALMQADLQQDLRVDSGKPLVFHQLIQVADNRWYWYQRYHHLLVDGFSFPAITRQIANIYCTWL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
SS


SS
SS
S
SSSSTTT

TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence RGEPTPASPFTPFADVVEEYQQYRESEAWQRDAAFWAEQRRQLPPPASLSPAPLPGRSASADILRLKLEF
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT






S

SS


B

SSSS



S




 .........220.........230.........240.........250.........260.........270.........280
Sequence TDGEFRQLATQLSGVQRTDLALALAALWLGRLCNRMDYAAGFIFMRRLGSAALTATGPVLNVLPLGIHIA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
S
SSSS
TT
SSS
TS

S



 .........290.........300.........310.........320.........330.........340.........350
Sequence AQETLPELATRLAAQLKKMRRHQRYDAEQIVRDSAAGDEPLFGPVLNIKVFDYQLDIPDVQAQTHTLATG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT
BTTTTS




SS
S
S








BTT

 .........360.........370.........380.........390.........400.........410.........420
Sequence PVNDLELALFPDVHGDLSIEILANKQRYDEPTLIQHAERLKMLIAQFAADPALLCGDVDIMLPGEYAQLA
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

SS
TTS
TTT


TT
BTTS




 .........430.........440.........450.........460.........470.........480.........490
Sequence QLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFSYREMREQVVALANLLRERGVKPGDSVAVALP
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) T






S


SSS
SS
TT

TT


 .........500.........510.........520.........530.........540.........550.........560
Sequence RSVFLTLALHAIVEAGAAWLPLDTGYPDDRLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTP
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SSTT


TTS


S
TTTTSSSS



S



 .........570.........580.........590.........600.........610.........620.........630
Sequence QGSAPLQLSQPHHTAYIIFTSGSTGRPKGVMVGQTAIVNRLLWMQNHYPLTGEDVVAQKTPCSFDVSVWE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)









TTS

SSSS
S


TT

S
TTSGGG
 .........640.........650.........660.........670.........680.........690.........700
Sequence FFWPFIAGAKLVMAEPEAHRDPLAMQQFFAEYGVTTTHFVPSMLAAFVASLTPQTARQSCATLKQVFCSG
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SGGGGTT


TT
TT
T


S

GGG


S
 .........710.........720.........730.........740.........750.........760.........770
Sequence EALPADLCREWQQLTGAPLHNLYGPTEAAVDVSWYPAFGEELAQVRGSSVPIGYPVWNTGLRILDAMMHP
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) S
T




GGGSS


ST

SS

B
TT
TTS
B
 .........780.........790.........800.........810.........820.........830.........840
Sequence VPPGVAGDLYLTGIQLAQGYLGRPDLTASRFIADPFAPGERMYRTGDVARWLDNGAVEYLGRSDDQLKIR
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)

TT

TTS

TT

TTSTT

TTS
SSST
 .........850.........860.........870.........880.........890.........900.........910
Sequence GQRIELGEIDRVMQALPDVEQAVTHACVINQAAATGGDARQLVGYLVSQSGLPLDTSALQAQLRETLPPH
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TTTSTT
S
S
GGG
SSS



SSSS


TTTS
GG
 .........920.........930.........940.........950.........960.........970.........980
Sequence MVPVVLLQLPQLPLSANGKLDRKALPLPELAPKAGSETIIAAAFSSLLGCDVQDADADFFALGGHSLLAM
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) GS
S
SS



SSS


SSSS








TT
S


SSS

TTTTT

 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence KLAAQLSRQVARQVTPGQVMVASTVAKLATIIDRMGFETILPLREGNGPTLFCFHPASGFAWQFSVLSRY
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SSS




S



SSS

SS



TTS

GGGGGGTTT
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence LDPQWSIIGIQSPRPNGPMQTAANLDEVCEAHLATLLEQQPHGPYYLLGYSLGGTLAQGIAARLRAREQV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S
TT



STT

SSTTTTTTTTTT

SS
TT


 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence AFLGLLDTWPPETLDPEVLAEINREREAFLAAQQGELFTTIEGNYADAVRLLTTAHSVPFDGKATLFVAE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S


TT


T




TTTS





SS
T
 .........1200.........1210.........1220.........1230........
Sequence RTLQEGMSPERAWSPWELDIYRQDCAHVDIISPGTFEKIGPIIRATLN
Predicted secondary structure
























SS confidence















































Known secondary structure (DSSP) TS


TTTSTT

S

TTGGGS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D