Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5j1lA_

Fold library idPDB HeaderMoleculeTitle
c5j1lA_2.27PDB header: hydrolaseChain: A: PDB Molecule: toxr-activated gene (tage);


Added to library: Fri Feb 10 02:42:02 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GLQKSFIMRLIPNDYPLESYRRVSAVLHNHTGLDLSTAINTPVYASASGVVGLASKGWNGGYGNLIKVFH
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
S

S
SS


SSS

TT

SS

S
GGGT

 .........80.........90.........100.........110.........120.........130.........140
Sequence PFGFKTYYAHLNKIVVKTGEFVKKGQLIGYSGNTGMSTGPHLHYEVRFLDQPINPMSFTKWNMKDFEEVF
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) GGGS


TT

TT




SS
SSSTT
TS

SSS
S
 .........150.........160
Sequence NKERSIRWQSLITIINRLMQ
Predicted secondary structure


SS confidence



















Known secondary structure (DSSP)
TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D