Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5j0aB_

Fold library idPDB HeaderMoleculeTitle
c5j0aB_2.74PDB header: transferaseChain: B: PDB Molecule: lymphokine-activated killer t-cell-originated protein


Added to library: Thu Feb 9 20:00:07 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)









TT

S


SS
TTSTTSS
GGG
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence LKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLH
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)


TTB

SS


SS




STTTTT




 .........150.........160.........170.........180.........190.........200.........210
Sequence QEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMEVTDPEACYIGTEPWKPKEAVEENGVITDKA
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) TTS
B

S


GGGTTTT



SSSB

TTSB


SS





GGG
BSTT


BT
 .........220.........230.........240.........250.........260.........270.........280
Sequence DIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
S
TT

BS
SSSTT
SS

GGGB
TBS




GGG

STT
 .........290.........300...
Sequence VCTNEDPKDRPSAAHIVEALEAA
Predicted secondary structure








SS confidence






















Known secondary structure (DSSP) T
SSGGGS

S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D