Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5izmA_

Fold library idPDB HeaderMoleculeTitle
c5izmA_3.40PDB header: translationChain: A: PDB Molecule: selenocysteine-specific elongation factor;


Added to library: Thu Feb 9 16:21:09 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GRRVNVNVGVLGHIDSGKTALARALSTTAITLDLGFSCFSVPLPARLRSSPLLQVTLVDCPGHASLIRTI
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

STTSS




S


GGGG






GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence IGGAQIIDLXXLVIDVTKGXQTQSAECLVIGQIACQKLVVVLNKIDLLPEGKRQAAIDKXTKKXQKTLEN
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTS
SSSS
S

S

SSS
TTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence TKFRGAPIIPVAAKPGGAPQGIPELIELLTSQISIPTRDPSGPFLXSVDHCFSIGTVXTGTILSGSISLG
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) SS
TT


BS
S



BS








S



S
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence DSVEIPALKVVKKVKSXQXFHXPITSAXQGDRLGICVTQFDPKLLERGLVCAPESLHTVHAALISVEKIP
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
B
B
STTSS

B



B
SSSB
S
TT


SS

STT
SSSSS





T
 .........290.........300.........310.........320.........330.........340.........350
Sequence YFRGPLQTKAKFHITVGHETVXGRLXFFSPAPDNFDQEPILDSFNFSQEYLFQEQYLSPRQQWALVEFEK
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T

S

BSS


SS



STT
S




S


TTS

SB




S
 .........360.........370.........380.........390.........400.........410.........420
Sequence PVTCPRLCLVIGSRLDADIHTNTCRLAFHGILLHGLEDRNYADSFLPRLKVYKLKHKDDYSVQLFVGLKV
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)


TT
B

TTS
TT
SS


B



TTTGGG







TTB

TTTT
B
 .........430.........440.........450.........460
Sequence HLSTGELGIIDSFKIHIPGGLLSLTFKRYVFDTHKRXVQS
Predicted secondary structure













SS confidence







































Known secondary structure (DSSP)
BTTTB

B





B
SS






BTT
TTTT






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D