Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5izkB_

Fold library idPDB HeaderMoleculeTitle
c5izkB_3.25PDB header: translationChain: B: PDB Molecule: selenocysteine-specific elongation factor;


Added to library: Thu Feb 9 11:36:01 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VNVNVGVLGHIDSGKTALARALSTTCFSVPLPLLQVTLVDCPGHASLIRTIIGGAQIIDLMMLVIDVTMQ
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)

TTT













SSGGGG





 .........80.........90.........100.........110.........120.........130.........140
Sequence TQSAECLVIGQIACQKLVVVLNKIDLLPEGKRQAAIDKMTKKMQKTLENTKFRGAPIIPVAAKPGGIPEL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
S

TTSS
TTTTTSTTTT









T
 .........150.........160.........170.........180.........190.........200.........210
Sequence IELLTSQISTRDPSGPFLMSVMTGTILSGSISLGDSVEIPALKVVKKVKSMQMFHMPITSAMQGDRLGIC
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) GGG






S



S


TT
TTTT
SSS

S


SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence VTQFDPKLLERGLVCAPESLHTVHAALISVEKIPYFRGPLQTKAKFHITVGHETVMGRLMFFSPAPDNFD
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)



TTS
SS
STT
S
S
B
TT
SS

BTT



SS



B

TTGGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence QEPILDSFNFSQEYLFQEQYLSPRQQWALVEFEKPVTCPRLCLVIGSRCRLAFHGILLHGLEDRNYADSF
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)



SS


SSS

SB






SS


TT










STT
TTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence LPRLKVYKLKHKHGLVERAMDDYSVIGRSLFKQLFVGLKVHLSTGELGIIDSSGKFKIHIPGGLSPESKK
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) GGGS





SSTT

S




TT
TT









SS
S
TTTGG
 .........430.........440.........450.
Sequence ILTPSAERSEPSQHVVLSLTFKRYVFDTHKR
Predicted secondary structure



















SS confidence






























Known secondary structure (DSSP) G




STT






BSSSSS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D