Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ix1A_

Fold library idPDB HeaderMoleculeTitle
c5ix1A_2.60PDB header: transcriptionChain: A: PDB Molecule: morc family cw-type zinc finger protein 3;


Added to library: Thu Feb 9 21:17:54 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVISDHICLTFTDNGNGMTADKL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)







TTTTTT

SSTTT

STT
S



 .........80.........90.........100.........110.........120.........130.........140
Sequence HKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAMVFTKNGETMSVGFLSQTYLEVIKAEHVVVPI
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TSSS





BTTB




SS
SSTT
SS



 .........150.........160.........170.........180.........190.........200.........210
Sequence VTFNKHRQMINLTESKASLAAILEHSLFSTEQKLLAELNAIMGKKGTRIIIWNLRSYKNATEFDFEKDKY
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TTS
SSS

STS
SS
BSSSSBSSB
SS
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence DIRIPEDYKKQEIAPESDYSLRAYCSILYLKPRMQIIIRGQKVKTQLVSKSLAYIERDVYRPKFLTRTVR
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)

B











BSBSS

STT




SBTT

TT
SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence ITFGFNCRNKDHYGIMMYHKNRLIKAYEKVGCQNMGVGVVGIIECNFLKPTHNKQDFDYTNEYRLTILAL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SS
SS

TT

S



S
S
TTS
B
TTSSSB


 .........360.........370.........380.........390.........400.........410....
Sequence GEKLNDYWNEMKKRPDQTWVQCDACLKWRKLPDGIDQLPEKWYCSNNPDPQFRNCEVPEEPEDE
Predicted secondary structure







































SS confidence































































Known secondary structure (DSSP)






TTT


TT




SS

GGG
SSGGG
STTS







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D