Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5is5A_

Fold library idPDB HeaderMoleculeTitle
c5is5A_2.85PDB header: transferaseChain: A: PDB Molecule: phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic


Added to library: Thu Feb 9 15:58:06 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RVKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPNRAL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TS
TTT

TTS
S


B



 .........80.........90.........100.........110.........120.........130.........140
Sequence LVNVKFEGSEESFTFQVSTKDMPLALMACALRKVFRQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHS
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT


SS






GGGTTBS

SS

GGGB
 .........150.........160.........170.........180.........190.........200.........210
Sequence GLTPHLTMVHSSSILAMRDEQSNWSLEQPFSLIRKVNADMKLVVQAGLFHGNEMLCKTVSSSEVCEPFDI
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) T


T






B












TTSS










S
 .........220.........230.........240.........250.........260.........270.........280
Sequence SVCDLPRMARLCFALYADCPIAWANLMLFDYKDQLKTGERCLYMWPSLNPAGTVRGNPNTESAAALVIYL
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) BTTTS
TT



SB
TTSBB





SSS
SS

S
SSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence PEVPVYFPALEKILELGLYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELP
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)




B


TT


TT
GGGS
TT





 .........360.........370.........380.........390.........400.........410.........420
Sequence VLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGH
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TSTT


TT

TGGGT
SSSS
TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence FLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMM
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) TTTTSTTTS
TTS
 .........500.........510.........520.........530.........540.........550.........560
Sequence HMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLR
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TSSSTT

GGG

SSTT

TTTSS

 .........570.........580.........590.........600.........610.........620.........630
Sequence QDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNAAFNKDALLNWLKSK
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TT








TT

SST


SGGG
 .........640.........650.........660.........670.........680.........690.........700
Sequence NPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNRVPFILTYDFVHVI
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S
TTTT




TTSTTS






S








 .........710.........720.........730.........740.........750.........760.........770
Sequence QQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEAL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TTT
SS
TGGGG
BTTBSSTTSSS
 .........780.....
Sequence KHFRVKFNEALRESW
Predicted secondary structure


SS confidence














Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D