Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5irrB_

Fold library idPDB HeaderMoleculeTitle
c5irrB_2.04PDB header: hydrolaseChain: B: PDB Molecule: septin-like protein;


Added to library: Sat Apr 29 08:19:39 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KIWKKKYIKLIVVGDSGLGKTTLIKSLISIPGERLQVHDGSYTPTEQFRRDPESLSSTVSWRDEEDRVIW
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

SSTTSS

TTS











GGGGTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence VYKIQDTPGYGDELDVFRNLKXVQDYIESQNRKWLELEQARIEDPRVDLCIFCIPPHRLRPIDLKYXFEL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)



TTSSS









SS


 .........150.........160.........170.........180.........190.........200.........210
Sequence GKHVPVVPVVTKADTXTIREANTYRTEVANRIANPXVPGIHDKINIFKFERDTLERAGVQDHATPHPPFL
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TTS


GGGS




TT

S


B



TT



SSSS

 .........220.........230.........240.........250.........260.........270.........280
Sequence VIASNDISEELAAAEPPLFWPERRYPWGTAEAFNKEHSDLLAVRALLXKEALEEISKTKRARYEAWRRTT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)



S
B
TSSS



BTTTT
TTT
STTTTT
 .
Sequence L
Predicted secondary structure
SS confidence
Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D