Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5iooA_

Fold library idPDB HeaderMoleculeTitle
c5iooA_2.52PDB header: unknown functionChain: A: PDB Molecule: avpa;


Added to library: Thu Feb 9 22:03:13 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EINRKQAKEFYNSDXATALESCQKYGHALFXPELIDAKILATKGSSLLSNWLTAPSIRATGRTKQGNPVV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
BSSSBSSS



TT
S

TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence VYVHVDNYLSNPENIRNAERINGAGVXPVDEFQRLLDLGDNKNVFVIDYDKLKSSSSGVIPVERALEHPQ
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
S

GGGSS
TT

T

SSSTS

GGGTTTSTT
 .........150.........160.........170.........180.........190.........200.........
Sequence TIPFIGGEERAQRYLEKFKQVYGNNIGIWHCDDLKDEPLGRLLFVGDYCNNGLIGNYGIGNYARFVGVR
Predicted secondary structure






































SS confidence




































































Known secondary structure (DSSP) TST
S



SSS


SSS
S


SSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D