Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ingC_

Fold library idPDB HeaderMoleculeTitle
c5ingC_2.45PDB header: transferaseChain: C: PDB Molecule: putative carboxyl transferase;


Added to library: Sat Feb 11 00:25:07 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PTSTADRIADLAARHEEAVVLAEKKAADRQHLKGKLTARARIDLLLDPGSFVELDEFVRHRTVEAGIPRP
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

STT


S
TT


TT


S


TTS


 .........80.........90.........100.........110.........120.........130.........140
Sequence YGDGVVTGHGTIDGRQVCVFSHDFTTLGGSXGEAFGSKVVKIYDFAXSVGCPVIGINDSGGARIQEGVXS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTTTTT
TTSGGG
B
T





B
GGGT
 .........150.........160.........170.........180.........190.........200.........210
Sequence IAYYTELGVRNVHSSGVIPQISLIXGPCAGGSVYSPALTDFTVXVKDISYXFVTGPEVVSAVXGEQVTAE
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTTS

SGGGGSSTTT
SS
T




 .........220.........230.........240.........250.........260.........270.........280
Sequence QLGGPAVHAEVSGNAHYVGDDEQDAISWVQTLLGYLPPNNLDPAPVYDHDCAPGITEADLALDTVIPDSE
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
TS


SSSTTS
SSSSS


B





SS

GGGGSS
SSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence QQVYDXADVITAVLDDGDYLEIHPDFARNIICALGRVEGHSVAVVANQPRHLAGVLDIDASEKAARFIRF
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) S



SGGG

STTS
TTTT
TTTGGG
B
 .........360.........370.........380.........390.........400.........410.........420
Sequence CDSFNIPVLTFXDVPGYLPGVGQEHQGIIRRGIKLFYAYAESTVPKITVITRKAYGGGYAVXGSRQIGAD
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT



B

STT

S
TT
TTTT
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence RVXAWPTAEIAVXGANSAVAAVKENLVDDYRRRFGNPYEAAAHGYVDXVISPSRTRYEVARALASLRNKR
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
TT
S
STT




SSSTTT


SSSTTSSS

GGGTTT

 .........500...
Sequence QARPARKHGNIPL
Predicted secondary structure












SS confidence












Known secondary structure (DSSP)




SS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D