Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ijlA_

Fold library idPDB HeaderMoleculeTitle
c5ijlA_2.19PDB header: transferaseChain: A: PDB Molecule: dna polymerase ii large subunit;


Added to library: Thu Feb 9 11:03:56 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PKEMEEYFEMLQREIDKAYEIAKKARAQGKDPSLDVEIPQATDMAGRVESLVGPPGVAKRIRELVKEYGK
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
TTS
SS
SS
S

SS

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence EIAALKIVDEIIEGKFGDLGSREKYAEQAVRTALAILTEGIVSAPIEGIANVKIKRNTWADNSEYLALYY
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTTT



STTT
SS





TTTT

 .........150.........160.........170.........180.........190.........200.........210
Sequence AGPIRSSGGTAQALSVLVGDYVRRKLGLDRFKPSEKHIERMVEEVDLYHRAVTRLQYHPSPEEVRLAMRN
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
GGGGGGTT






T


SS


 .........220.........230.........240.........250.........260.........270.........280
Sequence IPIEITGEATDDVEVSHRDVPGVETNQLRGGAILVLAEGVLQKAKKLVKYIDKMGIEGWEWLKEFVEAKE
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
SS
S


SS
S
TT


S
TTTTTT

S
 .........290.........300.........310.........320.........330.........340.........350
Sequence KGVDMGFYYSLYQKFKEEPLFSDPSKPGGFRLRYGRSWGINPATMILVGAVVTPVTTIEGPIVKLKDGSV
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)







TTS
SSS

S









SSS


TTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence LRVDDYNLALKVREDVEEILYLGDAVIAFGDQTLLPANYCEEWWILEFVKALKEIYEVHLEPFTENEEES
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

SGGG

S















TTS


 .........430.........440.........450.........460.........470.........480.........490
Sequence IEEASDYLEIDPEFLKEMLRDPLRVKPPVELAIHFSEVLGIPLHPYYTLYWNSVEPKDVEKLWRLLKNYA
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) T


TTT








GGG


GGGS

 .........500.........510.........520.........530.........540.........550.........560
Sequence EIEWSNFRGIKFAKKIVISQEKLGDSKRTLELLGLPHTVRDGNVIVDYPWAAALLTPLGNLNWEFMAKPL
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TTTTTT

BTTTTTTTGGGTS




TT
 .........570.........580.........590.........600.........610.........620.........630
Sequence YATIDIINENNEIKLRDRGISWIGKPPVQVLFPIGLAGGSSRDIKKAAEEGKVAEVEIAFFKCPKCGHVG
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)


SS



S
S





SS

B
TTTTGGGTBTT




SSS

 .........640.........650.........660.........670.........680.........690.........700
Sequence PEHLCPNCGTRKELLWVCPRCNAEYPESQAEGYNYTCPKCNVKLRPYAKRKIRPSELLNRAMENVKVYGV
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) S
SB
TTT

B

TTT

TTTB
TTSSSB
BS

T



 .........710.........720.........730.........740.........750.........760.........770
Sequence DKLKGVMGMTSGWKMPEPLEKGLLRAKNDVYVFKDGTIRFDATDAPITHFRPREIGVSVEKLRELGYTHD
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) S

B
BSS

BSS




T



TTS



S
T

TT

B
 .........780.........790.........800.........810.........820.........830.........840
Sequence FEGKPLVSEDQIVELKPQDIILSKEAGRYLLKVAKFVDDLLEKFYGLPRFYNAEKMEDLIGHLVIGLAPH
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTS
B


TTS


TTTT



S


SSGGGGTT

TT
 .........850.........860.........870.........880.........890.........900.........910
Sequence TSAGIVGRIIGFVDALVGYAHPYFHAAKRRNCDGDEDAVMLLLDALLNFSRYYLPEKRGGKMDAPLVITT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

SSSS
TTTT
TTTTTTT



GGGSBSS


S



S
 .........920.........930.........940...
Sequence RLDPRYYPLEFYEATYELKSPKELVGVIERVED
Predicted secondary structure










SS confidence
































Known secondary structure (DSSP)







GGGT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D