Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5igwA_

Fold library idPDB HeaderMoleculeTitle
c5igwA_2.10PDB header: transferaseChain: A: PDB Molecule: macrolide 2'-phosphotransferase ii;


Added to library: Sat Apr 29 08:20:16 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SKDIKQVIEIAKKHNLFLKEETIQFNESGLDFQAVFAQDNNGIDWVLRLPRREDVMPRTKVEKQALDLVN
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
TT

B
GGG




SSBTTS

SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence KYAISFQAPNWIIYTEELIAYKKLDGVPAGTIDHGNYIWEIDINNVPELFHKSLGRVLAELHSIPSNKAA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

SSB



S
SS


SSS



SS
TTS

T

GGG
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence ALDLVVHTPEEARMSMKQRMDAVRAKFGVGENLWNRWQAWLNDDDMWPKKTGLIHGDVHAGHTMIDKDAN
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)


S
B




T
GGGS
S


S

STTT
TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence VTGLIDWTEAKVTDVSHDFIFNYRAFGEEGLEALILAYKEIGGYYWPKMKEHIIELNAAYPVSIAEFALV
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)


TT

GGGGGTT



TTTT
 .........290......
Sequence SGIEEYEQMAKEALEV
Predicted secondary structure





SS confidence















Known secondary structure (DSSP) T

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D