Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ifwB_

Fold library idPDB HeaderMoleculeTitle
c5ifwB_3.40PDB header: signaling proteinChain: B: PDB Molecule: transitional endoplasmic reticulum atpase;


Added to library: Thu Feb 9 19:56:15 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence STAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKI
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
SGGG

S


SS
TT

TT

TTS

SSS
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence RMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIF
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

TT

TT






B
SBTTTSTTS
TTT


TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVEL
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTSSS

TT


S

B


TTS

SSS

GGG

S
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence PLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEE
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
T




SSSTTSSTT
S
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence AEKNAPAIIFIDELDAIAPGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVD
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S
S
GGGT


T

GGG
S
GGGS
STTTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence IGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKDETIDAEVMNSL
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)




TSSS
TT



S

T



S
 .........430.........440.........450.........460.........470.........480.........490
Sequence AVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQKGVLFYGPPGCGKTLLAKAIA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
S



S








TTTS
S



SSTTSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence NECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKDRVINQILTEMDGMSNVF
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TT
GGGTS
GGG
S

SSSS
GGGG


T


 .........570.........580.........590.........600.........610.........620.........630
Sequence IIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLT
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S
GGGS
GGGG
TTT






TTS


SS



S

 .........640.........650.........660.........670.........680.........690.........700
Sequence EICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMF
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TSS
TT


SSS







T
S





T
 ..
Sequence AQ
Predicted secondary structure

SS confidence

Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D