Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ie2A_

Fold library idPDB HeaderMoleculeTitle
c5ie2A_1.85PDB header: ligaseChain: A: PDB Molecule: oxalate--coa ligase;


Added to library: Fri Feb 10 02:38:45 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MDSDTLSGLLENVAKKFPDRRALSVSGKFNLTHARLHDLIERAASRLVSDAGIKPGDVVALTFPNTVEFV
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


SSSTTSTTTS


TT


SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence IMFLAVIRARATAAPLNAAYTAEEFEFYLSDSDSKLLLTSKEGNAPAQEAASKLKISHVTATLLDAGSDL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT


TT

TTSS

TT



TTS

 .........150.........160.........170.........180.........190.........200.........210
Sequence VLSVADDSATELVNHPDDGALFLHTSGTTSRPKGVPLTQLNLASSVKNIKAVYKLTESDSTVIVLPLFHV
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) SS


TTTT



TTS


SSSS

T

TT


S
TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence HGLLAGLLSSLGAGAAVTLPAAGRFSATTFWPDMKKYNATWYTAVPTIHQIILDRHASHPETEYPKLRFI
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TTTTT

TTSS

TT


S

S




S
 .........290.........300.........310.........320.........330.........340.........350
Sequence RSCSASLAPVILSRLEEAFGAPVLEAYAMTEATHLMSSNPLPEEGPHKPGSVGKPVGQEMAILNEKGEIQ
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
SS



S
GGGT


TTT



TT

B
SS
TT

B
 .........360.........370.........380.........390.........400.........410.........420
Sequence EPNNKGEVCIRGPNVTKGYKNNPEANKAGFEFGWFHTGDIGYFDTDGYLHLVGRIKELINRGGEKISPIE
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TT

STTS
S

TT
TT
TTS
GGG
TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence VDAVLLTHPDVSQGVAFGVPDEKYGEEINCAVIPREGTTVTEEDIKAFCKKNLAAFKVPKRVFITDNLPK
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTSTTTTT
TT



S
GGGS
S

S


B
 .........500......
Sequence TASGKIQRRIVAQHFL
Predicted secondary structure








SS confidence















Known secondary structure (DSSP)
TTS
B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D