Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5idoA_

Fold library idPDB HeaderMoleculeTitle
c5idoA_2.20PDB header: transferaseChain: A: PDB Molecule: 3' terminal uridylyl transferase;


Added to library: Thu Feb 9 17:29:32 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VRLYSCDACPHAVFTTHAALLAHAEEHHADLLPDHARLRRIAQKLNPVWNRALNARRNTITSWGKKIFHV
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)



SS
SS
SSTTTTSTTTTGGGT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AAQRDAGESKMQEAHRARAQLECVVRRWHDKARVFIFGSSVAMGVWDGTADIDFAVVDVDAMERGSWPPL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)



TTSS


SSS
T

S

 .........150.........160.........170.........180.........190.........200.........210
Sequence EKNAVRSITELLRRVGFSFVNLEPISHARVPIIKHHASSPDVVARSIRFILNGPATREDRLLLEGSVRDA
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TT

TTT
SSSS






GGGGSS


 .........220.........230.........240.........250.........260.........270.........280
Sequence VGPTGVQQVWWNRTSDMMSATLESTTAAVRAAMCSPALASASLRTKVQPAHDECRPELYNIDFALSFRAF
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP)
TTS
TTSSSST




SSTT

SSSSS

GGGGS
S
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence GIRNSTLLRKYLLSHPCARPGAIVLKDWSKTSGVNNSVNGYFTSYAINIMWIYYLVQKGYVPYVDPLEIP
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TSTTTSB
GGGT
B
TTSS



GGGS
 .........360.........370.........380.........390.........400.........410.........420
Sequence ESLVNYTDFDPRYTPMIDPEITNTEREELYKAAGDMLVGFFYFYSFEFDWGHNVISLNRPGITTKRMLGW
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) S

TT


SS




SS
TT

TS
TTTB
SSSSS
T
 .........430.........440.........450.........460.........470.
Sequence HVEDVVHPTRYELCIEDPYEENLNLGRHIGVTKSLRVRTELYRGLLSLLKE
Predicted secondary structure

























SS confidence


















































Known secondary structure (DSSP) SS








SS
BB
SSSTT
BTTTT

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D