Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5i99A_

Fold library idPDB HeaderMoleculeTitle
c5i99A_2.40PDB header: cell adhesionChain: A: PDB Molecule: contactin-3;


Added to library: Thu Feb 9 22:58:39 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PGSAPDFSRNPMKKMVQVQVGSLVILDCKPRASPRALSFWKKGDMMVREQARVSFLNDGGLKIMNVTKAD
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)


SSS


STT





S

TT



SS
TTS

S

GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence AGTYTCTAENQFGKANGTTHLVVTEPTRIILAPSNMDVAVGESVILPCQVQHDPLLDIMFAWYFNGALTD
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)
TT






TT





TTS

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence FKKDGSHFEKVGGSSSGDLMIRNIQLKHSGKYVCMVQTGVDSVSSAAELIVRGSPGPPENVKVDEITDTT
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP) SGGGTTS
S
TT



S

GGG
TT
S



S

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence AQLSWTEGTDSHSPVISYAVQARTPFSVGWQSVRTVPEVIDGKTHTATVVELNPWVEYEFRIVASNKIGG
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)




SS

SSSSS

SSSTT

S

TT
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence GEPSLPSEKVRTEEAAPEIAPSEVSGGGGSRSELVITWDPVPEELQNGGGFGYVVAFRPLGVTTWIQTVV
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP)


















S




STT




GGGS
SSS
TT



 .........360.........370.........380.........390........
Sequence TSPDNPRYVFRNESIVPFSPYEVKVGVYNNKGEGPFSPVTTVFSAEEE
Predicted secondary structure

























SS confidence















































Known secondary structure (DSSP)

TTS
STTS
TT
TT








Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D