Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5i2cA_

Fold library idPDB HeaderMoleculeTitle
c5i2cA_1.80PDB header: signaling proteinChain: A: PDB Molecule: gats-like protein 3;


Added to library: Thu Feb 9 13:56:56 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQ
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
GGG
GGG




SSTT



TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence VAEATWLVLNVSSHQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAQEFDIYR
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
SS






BGGGGTTTTTT


SS
GGGTTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence EVGGEPVPVTRHGPSPTVHPIQSPQNRFCVLTLDPETLPAIATTLIDVLFYSHSTPKEAASSSPEPSSIT
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) TT
















B

GGGTGGGSS






TTT
SS
S


 .........220.........230.........240.........250.........260.........270.........280
Sequence FFAFSLIEGYISIVMDAETQKKFPSDLLLTLWRMVRIGGQPLGFDECGIVAQIAGPLAAADISAYYISTF
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TTGGGGGGS
TTTSB


SS

TTT

STT

B
S
 .........290.........300..
Sequence NFDHALVPEDGIGSVIEVLQRR
Predicted secondary structure




SS confidence





















Known secondary structure (DSSP) S
GGGT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D