Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5i1wD_

Fold library idPDB HeaderMoleculeTitle
c5i1wD_2.15PDB header: oxidoreductaseChain: D: PDB Molecule: crmk;


Added to library: Thu Feb 23 10:28:30 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TRAAVTVKPDDHRYDLLARADNYRFVAQPEYFRLPYSTAQVVEAVSEAVAAGKRLTVRSGGHCGEAFVAS
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)




TTSTT

S
TT




S
SSTT

SS


SSSTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence PDVDVIVDLSSMSHVGYDEERGAFEVEAGATVGQIYRVLYKNYGVTFPGGFCMGVGAGGHISGGGYGPLS
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT


TT


TTTTTT
BS





SBTT
BTT


TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence RLLGLTVDYLHAVEVVVVDAEGVVSTVVATREEDDPNRDLWWAHTGGGGGNFGVITRYWLRSPDAVGDAP
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

GGGG
TTS
S
TT
TTTTTS
TTSSS

TT

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence EEALPRPPASFHVARVSWSWAELTEADYVRLVSNFLDWQLRNCTVDSPNIGLYALLECFHRSAGHLAMHA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S



SSTT

S
STT
TTTT

GGGS
 .........290.........300.........310.........320.........330.........340.........350
Sequence QIPVDVPDAEERMSWFLAELNEGVAVAPSLTRRRLPWLATSQLLAIPDVGPGAIGVRRKVKSADLRGPHT
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) TTSTTTT
SS

SSB
SSSTTTSS
SS


 .........360.........370.........380.........390.........400.........410.........420
Sequence REQLAAAYRHLSRADYHCPSAAMEYIAYGGRVNTVDPAATAVPRGASLKTFYMVAWTDPDEDEEHLRWIR
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) S
TT


TT


GGGGGS
TTTSSS



SS
GGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence EIYRDIHSATGGVPTPDEVNTGAYINYPDIDLADPEWNTSGVPWHTIYYGDNYPRLQEIKSRWDPRNVFR
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TGGGTTS

SSSS

TTS

GGGG
TTT

SS

GGG
TT

S
 ........
Sequence HAFSIRPR
Predicted secondary structure







SS confidence







Known secondary structure (DSSP)
TT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D