Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5i0iB_

Fold library idPDB HeaderMoleculeTitle
c5i0iB_3.15PDB header: motor proteinChain: B: PDB Molecule: unconventional myosin-x;


Added to library: Thu Feb 9 12:19:02 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NFFTEGTRVWLRENGQHFPSTVNSCAEGIVVFRTDYGQVFTYKQSTITHQKVTAMHPTNEEGVDDMASLT
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)



TT
TTTTTTS
GGG

TTTS
TT


S

SBGGG
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence ELHGGSIMYNLFQRYKRNQIYTYIGSILASVNPYQPIAGLYEPATMEQYSRRHLGELPPHIFAIANECYR
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) S
STT

TT

SS

TTTT
S
TTSSS

 .........150.........160.........170.........180.........190.........200.........210
Sequence CLWKRHDNQCILISGESGAGKTESTKLILKFLSVISQQSLELSLKEKTSCVERAILESSPIMEAFGNAKT
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SSS

BTTSSTTT




S

TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence VYNNNSSRFGKFVQLNICQKGNIQGGRIVDYLLEKNRVVRQNPGERNYHIFYALLAGLEHEEREEFYLST
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) SS
TT
S
TTS



GGGGT


TT

SBS
TT


 .........290.........300.........310.........320.........330.........340.........350
Sequence PENYHYLNQSGCVEDKTISDQESFREVITAMDVMQFSKEEVREVSRLLAGILHLGNIEFITAGGAQVSFK
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) GGG
TT






TTT

TT

SSSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence TALGRSAELLGLDPTQLTDALTQRSMFLRGEEILTPLNVQQAVDSRDSLAMALYACCFEWVIKKINSRIK
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) T



TT




 .........430.........440.........450.........460.........470.........480.........490
Sequence GNEDFKSIGILDIFGFENFEVNHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLVWEDIDWIDNGEC
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)


SS


B


SSB
TTT










 .........500.........510.........520.........530.........540.........550.........560
Sequence LDLIEKKLGLLALINEESHFPQATDSTLLEKLHSQHANNHFYVKPRVAVNNFGVKHYAGEVQYDVRGILE
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) STTST
TT

TT
TT

SS
TTTT
TT
 .........570.........580.........590.........600.........610.........620.........630
Sequence KNRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNNQDTLKCGSKHRRPTVSSQFKDSLHSLMATLSSSNPF
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

B
TT
SSSS


B



SS


SS




TTS
 .........640.........650.........660.........670.........680.........690.........700
Sequence FVRCIKPNMQKMPDQFDQAVVLNQLRYSGMLETVRIRKAGYAVRRPFQDFYKRYKVLMRNLALPEDVRGK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
S
SS

SS


TTS

GGGGTTS


SS
 .........710.........720.........730.........740.........750.........760.........770
Sequence CTSLLQLYDASNSEWQLGKTKVFLRESLEQKLEKRREEEVSHAAMVIRAHVLGFLARKQYRKVLYCVVII
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)
TTS
S
SS
 .........780....
Sequence QKNYRAFLLRRRFL
Predicted secondary structure
SS confidence













Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D