Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5hyxB_

Fold library idPDB HeaderMoleculeTitle
c5hyxB_2.60PDB header: transferaseChain: B: PDB Molecule: probable lrr receptor-like serine/threonine-protein kinase


Added to library: Thu Feb 9 16:02:06 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CNWTGVKCNRRGEVSEIQLKEKQLQGSLLKSLTSLTLSSLQLTGVIPKEIGDFTELELLDLSDNSLSGDI
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)

STT
TTS
S



S


TT

SS


SB

GGGGG
TT
S

SS

BS

 .........80.........90.........100.........110.........120.........130.........140
Sequence PVEIFRLKKLKTLSLNTNNLEGHIPMEIGNLSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGGNKNLR
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)
GGGGG
TT



SS


S


GGGGG
TT



SS



GGGGG
SS



S
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence GELPWEIGNCENLVMLGLAETSLSGKLPASIGNLKRVQTIAIYTSLLSGPIPDEIGYCTELQNLYLYQNS
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)


GGGGG
TT



SS


GGGGG
SS



SS

GGGGG
TT



SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence ISGSIPTTIGGLKKLQSLLLWQNNLVGKIPTELGNCPELWLIDFSENLLTGTIPRSFGKLENLQELQLSV
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) S


GGGGG
TT



SS



GGGGG
TT



SSSB

GGGGG
TT



S
 .........290.........300.........310.........320.........330.........340.........350
Sequence NQISGTIPEELTNCTKLTHLEIDNNLITGEIPSLMSNLRSLTMFFAWQNKLTGNIPQSLSQCRELQAIDL
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) S

BS


GGGGG
TT



SS




GGGGG
TT



SS


GGGGG
TT


 .........360.........370.........380.........390.........400.........410.........420
Sequence SYNSLSGSIPKEIFGLRNLTKLLLLSNDLSGFIPPDIGNCTNLYRLRLNGNRLAGSIPSEIGNLKNLNFV
Predicted secondary structure

































































SS confidence





































































Known secondary structure (DSSP)
SS


GGGGG
SS



SS


GGGGG
TT



SS


GGGGG
SS

 .........430.........440.........450.........460.........470.........480.........490
Sequence DISENRLVGSIPPAISGCESLEFLDLHTNSLSGSLLGTTLPKSLKFIDFSDNALSSTLPPGIGLLTELTK
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)

SS
S


GGGGG
TT



SS




TTTS
TT
S

SS
SB

GGGGG
SS

 .........500.........510.........520.........530.........540.........550.........560
Sequence LNLAKNRLSGEIPREISTCRSLQLLNLGENDFSGEIPDELGQIPSLAISLNLSCNRFVGEIPSRFSDLKN
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)

SS




GGGGG
TT



SS
SB

SGGGG
TT

S

SS

BS


GGGGG
TT
 .........570.........580.........590.........600.........610.........620......
Sequence LGVLDVSHNQLTGNLNVLTDLQNLVSLNISYNDFSGDLPNTPFFRRLPLSDLASNRGLYISNAIST
Predicted secondary structure




















































SS confidence

































































Known secondary structure (DSSP)



SS


S
SGGGTT
TT



SS




TS
TSS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D