Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5hxwF_

Fold library idPDB HeaderMoleculeTitle
c5hxwF_2.63PDB header: oxidoreductaseChain: F: PDB Molecule: l-amino acid deaminase;


Added to library: Thu Feb 9 12:42:30 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GFVEGTEGALPKQADVVVVGAGILGIMTAINLVERGLSVVIVEKGNIAGEQSSRFYGQAISYKMPDETFL
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)






SS

SB
S

ST


SSSTT
SGGGS




TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence LHHLGKHRWREMNAKVGIDTTYRTQGRVEVPLDEEDLVNVRKWIDERSKNVGSDIPFKTRIIEGAELNQR
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SSS







SS

SSSS



T
 .........150.........160.........170.........180.........190.........200.........210
Sequence LRGATTDWKIAGFEEDSGSFDPEVATFVMAEYAKKMGVRIYTQCAARGLETQAGVISDVVTEKGAIKTSQ
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) STT
SS



TT


TTTT
TT


SSSS

SS


S
 .........220.........230.........240.........250.........260.........270.........280
Sequence VVVAGGVWSRLFMQNLNVDVPTLPAYQSQQLISGSPTAPGGNVALPGGIFFREQADGTYATSPRVIVAPV
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

GGGTTT







TT


STTT
TTS


S

 .........290.........300.........310.........320.........330.........340.........350
Sequence VKESFTYGYKYLPLLALPDFPVHISLNEQLINSFMQSTHWNLDEVSPFEQFRNMTALPDLPELNASLEKL
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP)
TGGGGGGGGS
SSS

SS
S


TTS

T
S





 .........360.........370.........380.........390.........400.........410.........420
Sequence KAEFPAFKESKLIDQWSGAMAIAPDENPIISEVKEYPGLVINTATGWGMTESPVSAELTADLLLGKKPVL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
GGGTT


TTS


TTSTT

S
T


SS
 .........430
Sequence DPKPFSLYRF
Predicted secondary structure









SS confidence









Known secondary structure (DSSP)

GGG
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D