Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5hxgA_

Fold library idPDB HeaderMoleculeTitle
c5hxgA_2.00PDB header: transcriptionChain: A: PDB Molecule: uncharacterized protein stm1697;


Added to library: Thu Feb 23 10:41:05 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RYFFMAEPIRAMEGDLLGVEIITHFVISSWDNSQKRRFLLDLLRTIAAKHGWFLRHGLFCIVNIDRGMAQ
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)

TTS


GGGS
TTTT


 .........80.........90.........100.........110.........120.........130.........140
Sequence LVLQDKDIRALLHAMLFVELQVAEHFSCQDNVLVDPLIHALHKQPNPLWLGDLGVGNATAAPLVCGCFSG
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

TT
GGGS
SS
SS

SSS
TSSSS
STT

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence VKLDRSFFVSQIEKMTFPLLVKHIRHYCDKIVVGGQENARYLPALKTAGIWATQGTLFPSVALEEIETLL
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TSTT
S




SSTTT


STTS

GGGGGGS
 .
Sequence L
Predicted secondary structure
SS confidence
Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D