Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5hw4C_

Fold library idPDB HeaderMoleculeTitle
c5hw4C_2.21PDB header: transferaseChain: C: PDB Molecule: ribosomal rna small subunit methyltransferase i;


Added to library: Thu Feb 9 12:49:38 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MGQLYIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFGINARLFALHQQKAETLLAKLQEG
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)




B
SS
GGGS
SSS
TT







TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence QNIALVSDAGTPLINDPGYHLVRTCREAGIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRD
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


SSB
TTSSSS
TT







S

SS

SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence ALKAIEAEPRTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRR
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT

S
TTT
TT
STTSTT
T
GGGG
 .........220..
Sequence KGEMVLIVEGHK
Predicted secondary structure




SS confidence











Known secondary structure (DSSP)
S





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D