Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5hsjB_

Fold library idPDB HeaderMoleculeTitle
c5hsjB_1.90PDB header: lyaseChain: B: PDB Molecule: putative decarboxylase;


Added to library: Thu Feb 9 18:05:09 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LKDLDLNALFIGDKAENGQLYKDLLNKLVDEHLGWRKNSDPNMIGPEDQNSPAFKKTVGHMKTVLDQLSE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TT

GGGSB

TT
TT




SS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence RIRTESVPWHSAGRYWGHMNSETLMPALLAYNYAMLWNGNNVAYESSPATSQMEEEVGQEFARLMGYDYG
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S




TTTSS




BTTT
BTTSGGG
TT
TB
 .........150.........160.........170.........180.........190.........200.........210
Sequence WGHIVADGSLANLEGLWYARNIKSLPFAMKEVNPELVAGKSDWELLNMPTKEIMDLLENAGSQIDEVKKR
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) S

GGGGTT

TT

GGGT
 .........220.........230.........240.........250.........260.........270.........280
Sequence SARSGKNLQRLGKWLVPQTKHYSWMKAADIIGIGLDQVVPVPIDSNYRMDIQALESIIRKYAAEKTPILG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) SGGGS
STGGG
TT

TTS
GGG
B
TTSSB
TT

 .........290.........300.........310.........320.........330.........340.........350
Sequence VVGVAGSTEEGAVDGIDKIVALRQKLQKEGIYFYLHVDAAYGGYARALFLDEDDQFIPYKNLQKVHAENH
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) BS
TTT

B

TTT


TTTGGGGGGGB
TTS
B

GGGTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence VFTEDKEYIKPEVYAAYKAFDQAESITIDPHKMGYVPYSAGGIVIQDIRMRDTISYFLLGAYILEGSKAG
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) SSSS
S

S
GGGGSS
TTTTT


SS
SBGGGGGGT



GGGGSSS


B
 .........430.........440.........450.........460.........470.........480.........490
Sequence ATAASVWAAHHTLPLNVTGYGKLEGASIEGAHRYYDFLKNLKFEVAGKRISVHPLISPDFNMVDYVLKED
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S
SSTTTTT
TT
S

SSST
 .........500.........510.........520.........530.........540.........550.........560
Sequence GNDDLIEMNRLNHAFYEQASYVKGSLYGKEYIVSHTDFAIPDYGDSPLAFVESLGFSEVEWRHAGKVTII
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) T


TS

TT

S

S
TTTTTT


 .........570.........580.........590.....
Sequence RASVMTPYMNQRENFDYFAPRIKKAIQADLEKVYA
Predicted secondary structure








SS confidence


































Known secondary structure (DSSP)


SGGGS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D