Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5hmqE_

Fold library idPDB HeaderMoleculeTitle
c5hmqE_2.37PDB header: lyaseChain: E: PDB Molecule: 4-hydroxyphenylpyruvate dioxygenase;


Added to library: Thu Feb 9 20:08:19 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AKXQRSIATVSLSGTLPEKLEAIAAAGFDGVEIFENDLLYYAGSPRQVRQXCADLGIAITLFQPFRDFEG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)



BGGGS
S
TT
S
SS
T
S
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence CRRDRLQKNLDRAERKFDLXQELGTDLVLVCSNVQADALGDEQLLVDDLRLLGEHAGKRGLRIGYEALAW
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

GGGT





TT



T


TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence GRHVNTYQQVWNLVRQADHPALGVILDSFHTLSLKGDPSAIRDIPGDKIFFVQXADAPILAXDVLEWSRH
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
SS

S

TTTTT

GGGGGGS
GGG
B



SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence FRCFPGQGEXDXAGFLAPILATGYRGPLSLEIFNDGFAAPTRQNAADGLRSLLYLEEQTRLRLEQENTPI
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
B
TTSSSS
TT

S










TT


 .........290.........300.........310.........320.........330.........340.........350
Sequence EPGVLFSPPPASAYDGVEFLEFAVDEAVGARLGNWLKRLGFAEAGKHRSKEVQLLRQGDINIVLNAEPYS
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
TTSS









TT
SSSSTT

SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence FGHNFFEAHGPSLCATALRVKDQQAALKRATAFRGQPFRGLVGPNECEVPAVRAPDGSLLYLVEQGTLYD
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) SSS
TT


TT
TT

SSS

TTS





 .........430.........440.........450.........460.........470.........480.........490
Sequence TDFSLDNNATATGGLRRIDHXALALPAESLDSWVLFYKSLFDFAADDEVVGLVKSRALRSQCGTLRLPLN
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
TT









GGGS








TTSSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence ISENRNTAIAHALSSYRGSGVHHIAFDCDDIFREVARAKLAGVPLLEIPLNYYDDLAARFDFDDEFLSEL
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


TT
S



S
S
T

B



S


TT
 .........570.........580.........590.........600.........610.........620.
Sequence AYYNVLYDRDAQGGELFHVYTEPFEERFFFEIIQRKAGYAGYGAANVAVRLAAXAKARSGA
Predicted secondary structure





















SS confidence




























































Known secondary structure (DSSP) TT

TTS
B

GGGS
SS

S

GGGTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D