Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5hhaB_

Fold library idPDB HeaderMoleculeTitle
c5hhaB_1.24PDB header: hydrolaseChain: B: PDB Molecule: pvdo;


Added to library: Thu Feb 9 20:08:38 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GSSHHHHHHSQAKKPGTVFKDCKDCPEMVVLPAGSFTMGTPDDEVGRQPDEGPLHDVTFAKPFAISRYQV
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)

SS









TT

SSTTS


SS

TTSTT

TTS
S
SS
SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence TAGELDAYLKATGVKLADGDTRPGRECIAGKPRYQQGPRQPAVCVDYNDVKNYAAWLSKKTGKRYRMLSE
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) B





B

STT

BBTTB
SS


TTSB

S

SS



 .........150.........160.........170.........180.........190.........200.........210
Sequence AEREYGARAGSAGPFPFPFDEGKEYSIAKHANTYGASDGYNFTSPVGSFPPNAFGVYDMHGNVYEWVADC
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP) TT

SS
SS


TTSSS

TTT


SSGGGS
SS


TT
S


TTS


TTSS
 .........220.........230.........240.........250.........260.........270..
Sequence WHDHYNGAPSDGSAWMEEKCELVQIRGNDWGEPPIFSRSGNRNNAAPSDRGDWIGFRVAREL
Predicted secondary structure













































SS confidence





























































Known secondary structure (DSSP)

SS
TT

SSS




SS
S


TTS
GGG
STT


TT


TT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D