Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5hgqD_

Fold library idPDB HeaderMoleculeTitle
c5hgqD_3.28PDB header: ligase/ligase inhibitorChain: D: PDB Molecule: lysine--trna ligase;


Added to library: Thu Feb 9 11:27:21 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QEYFKLRTALINERRSKGINPYPHKFHVSISLADFIAKYNSLEKDVILNDIVQSVAGRVFSKRESKLIFY
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

TT

SS
S




S
TT

TT
SS


-
 .........80.........90.........100.........110.........120.........130.........140
Sequence DLHGEGTRLQVLANARFHSGDEAFDNLHDRIKRGDIIGVNGYPARSKSGELSIIPYEIIQLTPCLHMLPH
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TT
GGG

SSS
S
TT

TT




S



 .........150.........160.........170.........180.........190.........200.........210
Sequence TQETRYRMRYLDLIMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLIAGGATAKPFITHHNDLD
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)



TTTT




SSS

SS




TTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence MDLYLRVAPELYLKMLVVGGIDRVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYADYEDLMKITEDMLARM
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
S
STT
S





SS

ST

 .........290.........300.........310.........320.........330.........340.........350
Sequence VYYMHGTYKIQYHPNGIVENPVYEVDFTPPFRKVNIYDGLQEKLGIQFPPADTLDTDEANKFFDKLAVEN
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) SSS
SS
SS
S



SS
TS



S

SS

TTTT


 .........360.........370.........380.........390.........400.........410.........420
Sequence APRTTARLLDKLIGEFLEPTFISPTFLTGHPQIMSPLAKWHRSIPGLTERFELFVVTKEIVNAYTELNDP
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)



TTTSSGGG

S


BTTS
TTB
B
SSSTTBBS
TTB


S
 .........430.........440.........450.........460.........470.
Sequence LTQRLRFDENYCTALEYGLPPTAGWGMGIDRLAMILTDSNNIKEVLFFPAK
Predicted secondary structure

















SS confidence


















































Known secondary structure (DSSP)








T



T
S
GGGSSSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D