Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5hdfB_

Fold library idPDB HeaderMoleculeTitle
c5hdfB_2.71PDB header: hydrolaseChain: B: PDB Molecule: hydrolase;


Added to library: Thu Feb 9 13:54:32 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SAICRATTVEVTLGKGTGKXWGELCRPAGSSPDTVVTXVHGATYNHNYWDFPYQPDKYSFRKXLNGAGYA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

TT
TT


S

TT

GGGTS
SSS
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence TFVVDRLGTGNSTVPPSSELNLTVEARQXHEVVQGLRTGRIGGTGFGKVVLAGYSLGSAVTSIEASTFHD
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

TTSTTS



GGG

TTTTSS

ST

 .........150.........160.........170.........180.........190.........200.........210
Sequence VDAVLITALGHYNNPAGTQAIIDNGLSPNDDPVLKDRHHYDDGYATTKPGSRKHVFYADRPXDPGVLATD
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
SS

SS

T
GGG
TTTTTT



TT
TT
TTTT



 .........220.........230.........240.........250.........260.........270.........280
Sequence ELTKDANVFTEAADPLVIDPAVSRAIDVPVXFALGDRDPLXCGDGYEDCSSQAALRAQEAPFWTSAPSFD
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) T


GGGGG
GGGT
T

S
TT
TTTBSTTSB

S
GGG
TT
S
 .........290.........300.........310.........320
Sequence VILVEDAGHGLNLVPNTRVYQDASRDWLDRVVGHGLEHHH
Predicted secondary structure




















SS confidence







































Known secondary structure (DSSP) TT

S
GGGSTTT

S





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D