Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5hc4A_

Fold library idPDB HeaderMoleculeTitle
c5hc4A_2.00PDB header: hydrolaseChain: A: PDB Molecule: lipolytic enzyme;


Added to library: Thu Feb 9 16:21:30 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KIAEDPRIDPRIKAIFSGMDLGGGGDVESREAMLEAASSEEATAVRDGLRVFLDACDNEEIAPSAGLKIE
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)

TT
TTS
TT








S
TSTT

TTTS

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence DYEFTSEPDGNIAKIQYIRPDSTDKLPCVYYIHGGGMQSLSCYYGNYRAWGKIIASNGVAVAMVEFRNAL
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTT

SSS



STTTS

TTSTTT



SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence VPSALPEVAPYPAGLNDCVSGVKWVASHADELGIDASRIIIAGESGGGNLTLAAGLRLKQEGSQDLIQGL
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) S

SS




TTTTTT
GGG
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence YALCPYIAGSWPSEDSPSSTENNGILLDLHNNQGAMGYGIEAYEMRDPLAWPGFATEEDVSGLVPTFISV
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) S


SSSS
BTTBTTTTSS



SSTT
TTT
GGG

TT


 .........290.........300.........310.........320.........330.........340.
Sequence NECDPLRDEGINFYRLLLRAGVSAKCRQVMGTIHGTEIFPIACPDVSRDTAASIANFCKGG
Predicted secondary structure






















SS confidence




























































Known secondary structure (DSSP) TT
TTTT

TT

TTGGGSTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D