Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5h9xA_

Fold library idPDB HeaderMoleculeTitle
c5h9xA_1.91PDB header: hydrolaseChain: A: PDB Molecule: beta-1,3-glucanase;


Added to library: Thu Feb 23 10:15:49 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ADFTQGADVSGNNVTLWFKSSVNTTWVDVHYKVNSGVQQNVRMSFNAGAARFEHTILTAAQAEIEYFFTY
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

TTSSS


TT
S

TTTTTT
TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence NNGVPAYDTTTFTYRTNSIYSIPASSIPQPSEGGVSLKVMNGTGGAYTDDQIYWGVIGINPVNGKWSYLD
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) SSS






SGGGS
GGGS


STT
STTSS
GGG
TTT


 .........150.........160.........170.........180.........190.........200.........210
Sequence LAGRLLPISSDLNNAPGHLTKDGINYANIYHKISDANWVNLPKIESGRLFLSVGSPLYMKTFDDGFAGPD
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP) TTS


GGGGGSTT
TT



GGG
S

SSS



TT


 .........220.........230.........240.........250.........260.........270.........280
Sequence LNNPTDPNLNIIFDFVEFTVDKDGYHGNTTRVDQFGFPIQHRLVNLAGNYDRTVGELESETRSGLFAKYV
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TT
TT
TTTTSTT

SS
S
SSS

B
TT

 .........290.........300.........310.........320.........330.........340.........350
Sequence NEVPYEFKSLGTLQAPYRILSPMKGPFQEGGAYENYFAGYSSISTQDILLGVGEASNPEVCAALNRHVYT
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) S
GGGTTTTTT

GGGTTTSTTSTTTTTTTTT
SS
T
GGG
ST
TT
 .........360.........370.........380.........390.........400.........410..
Sequence EPDNWNRVDQYYQAAPANYYAKFWHDHSIDGLAYGFCYDDVNGQAAYLEVGDPKGLIVRVGW
Predicted secondary structure




































SS confidence





























































Known secondary structure (DSSP)
GGGTT
GGGTT
SSSS
TBGGG



STTTTTTT
SSSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D