Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5h7lB_

Fold library idPDB HeaderMoleculeTitle
c5h7lB_3.10PDB header: translation/ribosomal proteinChain: B: PDB Molecule: elongation factor 2;


Added to library: Sat Feb 24 08:40:37 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IAKIKELMLQPERIRNIGIAAHIDHGKTTLSDNLLAGAGMAANVSMVHNYEGKDYLINLIDTPGHVDFGG
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)


SS
TTS
TTSSTTT


TT


S

SSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence DVTRAMRAIDGVIIVVDAVEGVMPQTETVVRQALREYVKPVLFINKVDRLIRELKLTPQQMMERFSKIIM
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) S
STTT
S
TT

TT


 .........150.........160.........170.........180.........190.........200.........210
Sequence DVNRLIQRYAPEEYKKKWMVKVEDGSVAFGSAYYNWALSVPFMKRTGVKFNEIIDLTLKGDNRTLRQKAP
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) S
TTSTTTSS

GGGTSTTTT



T
TTSB
 .........220.........230.........240.........250.........260.........270.........280
Sequence LHVVVLDMVVRHLPSPIEAQKYRIPHLWEGDISSDIGQAMLNCDPKGKMVMVVTKIIIVATGRVWSGTVK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S


SS
TTSTTTTT
SSS




S
B
 .........290.........300.........310.........320.........330.........340.........350
Sequence SGQEVYLINTKRKARIQQVGIYMGPERINMEAVPAGNIVAVTGLRDAMAGETVAEEQIEPFEALHYVSEP
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TT
GGGT
S


SBT


S
B
SSS
S
SS

TT
SS



SS







 .........360.........370.........380.........390.........400.........410.........420
Sequence VVTVAIEAKNVKDLPRLIEALRQLAKEDPTLHVKIDEETGQHLLSGMGELHLEVKLYKLKKDWGIDIEVS
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
SSGGG
TT


TTTT
SSTS



 .........430.........440.........450.........460.........470.........480.........490
Sequence EPIVVYRESITKSSPMVEGKSPNRHNRFYIVVEPMPDEIYNAIKEGIIPEGRVKNPKEVAKKLAELGMDY
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)



SS




TTS



TTSS


S
TT

 .........500.........510.........520.........530.........540.........550.........560
Sequence EIARGIVDIYNGNMFIDNTKGVQYLNEVMDLLIDGFHQAMDEGPLAREPVMKVIVRLLDAQVHEDNVHRG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT
SS

SS
TTS
TTTS

B
S

S
GGGSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence PAQIYPAIRTAIHCAMMKSNPVLYEPYQKVIINIPYEYMGAVSREITQRRGQLVDMKQEGEVMTIIAEAP
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TS
GGGTTT
TT
 .........640.........650.........660.........670.........680.........690.
Sequence VAEMFGFAGSIRSATSGRALWSTEHAGFKRVPNELAQQIIRQIRQRKGLDPNPPTEKDVCP
Predicted secondary structure
























SS confidence




























































Known secondary structure (DSSP) GGG
TTTTT



TTS
SS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D