Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5h7lB_

Fold library idPDB HeaderMoleculeTitle
c5h7lB_3.10PDB header: translation/ribosomal proteinChain: B: PDB Molecule: elongation factor 2;


Added to library: Sat Feb 24 08:40:37 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IAKIKELMLQPERIRNIGIAAHIDHGKTTLSDNLLAGAGMAANVSMVHNYEGKDYLINLIDTPGHVDFGG
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)


SS
TTS
TTSSTTT


TT


S

SSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence DVTRAMRAIDGVIIVVDAVEGVMPQTETVVRQALREYVKPVLFINKVDRLIRELKLTPQQMMERFSKIIM
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) S
STTT
S
TT

TT


 .........150.........160.........170.........180.........190.........200.........210
Sequence DVNRLIQRYAPEEYKKKWMVKVEDGSVAFGSAYYNWALSVPFMKRTGVKFNEIIDLTLKGDNRTLRQKAP
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) S
TTSTTTSS

GGGTSTTTT



T
TTSB
 .........220.........230.........240.........250.........260.........270.........280
Sequence LHVVVLDMVVRHLPSPIEAQKYRIPHLWEGDISSDIGQAMLNCDPKGKMVMVVTKIIIVATGRVWSGTVK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S


SS
TTSTTTTT
SSS




S
B
 .........290.........300.........310.........320.........330.........340.........350
Sequence SGQEVYLINTKRKARIQQVGIYMGPERINMEAVPAGNIVAVTGLRDAMAGETVAEEQIEPFEALHYVSEP
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TT
GGGT
S


SBT


S
B
SSS
S
SS

TT
SS



SS







 .........360.........370.........380.........390.........400.........410.........420
Sequence VVTVAIEAKNVKDLPRLIEALRQLAKEDPTLHVKIDEETGQHLLSGMGELHLEVKLYKLKKDWGIDIEVS
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
SSGGG
TT


TTTT
SSTS



 .........430.........440.........450.........460.........470.........480.........490
Sequence EPIVVYRESITKSSPMVEGKSPNRHNRFYIVVEPMPDEIYNAIKEGIIPEGRVKNPKEVAKKLAELGMDY
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)



SS




TTS



TTSS


S
TT

 .........500.........510.........520.........530.........540.........550.........560
Sequence EIARGIVDIYNGNMFIDNTKGVQYLNEVMDLLIDGFHQAMDEGPLAREPVMKVIVRLLDAQVHEDNVHRG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT
SS

SS
TTS
TTTS

B
S

S
GGGSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence PAQIYPAIRTAIHCAMMKSNPVLYEPYQKVIINIPYEYMGAVSREITQRRGQLVDMKQEGEVMTIIAEAP
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TS
GGGTTT
TT
 .........640.........650.........660.........670.........680.........690.
Sequence VAEMFGFAGSIRSATSGRALWSTEHAGFKRVPNELAQQIIRQIRQRKGLDPNPPTEKDVCP
Predicted secondary structure
























SS confidence




























































Known secondary structure (DSSP) GGG
TTTTT



TTS
SS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D