Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5h63C_

Fold library idPDB HeaderMoleculeTitle
c5h63C_1.92PDB header: transferaseChain: C: PDB Molecule: transferase;


Added to library: Sat Dec 23 08:23:46 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GHVSFAGIDYPLLPLNHQTPLVFQWFERNPDRFGQNEIPIINTQKNPYLNNIINAAIIEKERIIGIFVDG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TT
TTS

S
GGGS
TTS
SS


SS

TTTS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence DFSKGQRKALGKLEQNYRNIKVIYNSDLNYSMYDKKLTTIYLENITKLEAQSASERDEVLLNGVKKSLED
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)


STTGGGS

GGG

BS
TTT

 .........150.........160.........170.........180.........190.........200.........210
Sequence VLKNNPEETLISSHNKDKGHLWFDFYRNLFLLKGSDAFLEAGKPGCHHLQPGGGCIYLDADMLLTDKLGT
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TT
BTTTT

GGGTTTTT
TT
TTS
TT
TT
SS



 .........220.........230.........240.........250.........260.........270.........280
Sequence LYLPDGIAIHVSRKDNHVSLENGIIAVNRSEHPALIKGLEIMHSKPYGDPYNDWLSKGLRHYFDGSHIQD
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTTTTT
TT
TT







TT

S
 .........290.........300..
Sequence YDAFCDFIEFKHENIIMNTSSL
Predicted secondary structure








SS confidence





















Known secondary structure (DSSP) B


TT

GGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D