Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5h60A_

Fold library idPDB HeaderMoleculeTitle
c5h60A_3.64PDB header: transferaseChain: A: PDB Molecule: transferase;


Added to library: Sat Dec 23 08:26:34 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SFNGKDYPLCFLDEKTPLLFQWFERNPARFGKNDIPIINTEKNPYLNNIIKAATIEKERLIGIFVDGDFF
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

SSS





TT


S
GGGS
SSS

S


SS

TSSS
S


 .........80.........90.........100.........110.........120.........130.........140
Sequence PGQKDAFSKLEYDYENIKVIYRNDIDFSMYDKKLSEIYMENISKQESMPEEKRDCHLLQLLKKELSDIQE
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
TTGGGS

GGG


S
TTTS
TS
 .........150.........160.........170.........180.........190.........200.........210
Sequence GNDSLIKSYLLDKGHGWFDFYRNMAMLKAGQLFLEADKVGCYDLSTNSGCIYLDADMIITEKLGGIYIPD
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S


TTTT

TTTTTT
SS

S

SS


TT

S




TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence GIAVHVERIDGRASMENGIIAVDRNNHPALLAGLEIMHTKFDADPYSDGVCNGIRKHFNYSLNEDYNSFC
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) S
SS
SSSS
STT







T

SSS
 .........290.........300....
Sequence DFIEFKHDNIIMNTSQFTQSSWAR
Predicted secondary structure









SS confidence























Known secondary structure (DSSP) B


SS

T

SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D