Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5h60A_

Fold library idPDB HeaderMoleculeTitle
c5h60A_3.64PDB header: transferaseChain: A: PDB Molecule: transferase;


Added to library: Sat Dec 23 08:26:34 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SFNGKDYPLCFLDEKTPLLFQWFERNPARFGKNDIPIINTEKNPYLNNIIKAATIEKERLIGIFVDGDFF
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

SSS





TT


S
GGGS
SSS

S


SS

TSSS
S


 .........80.........90.........100.........110.........120.........130.........140
Sequence PGQKDAFSKLEYDYENIKVIYRNDIDFSMYDKKLSEIYMENISKQESMPEEKRDCHLLQLLKKELSDIQE
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
TTGGGS

GGG


S
TTTS
TS
 .........150.........160.........170.........180.........190.........200.........210
Sequence GNDSLIKSYLLDKGHGWFDFYRNMAMLKAGQLFLEADKVGCYDLSTNSGCIYLDADMIITEKLGGIYIPD
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S


TTTT

TTTTTT
SS

S

SS


TT

S




TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence GIAVHVERIDGRASMENGIIAVDRNNHPALLAGLEIMHTKFDADPYSDGVCNGIRKHFNYSLNEDYNSFC
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) S
SS
SSSS
STT







T

SSS
 .........290.........300....
Sequence DFIEFKHDNIIMNTSQFTQSSWAR
Predicted secondary structure









SS confidence























Known secondary structure (DSSP) B


SS

T

SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D