Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5h5yB_

Fold library idPDB HeaderMoleculeTitle
c5h5yB_2.30PDB header: transferaseChain: B: PDB Molecule: non-lee encoded effector protein nleb;


Added to library: Sat Dec 30 08:26:09 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QTVSFAGKEYELKVIDEKTPILFQWFEPNPERYKKDEVPIVNTKQHPYLDNVTNAARIESDRMIGIFVDG
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
TT
TT

S
GGGS
TT

SS


SS

STTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence DFSVNQKTAFSKLERDFENVMIIYREDVDFSMYDRKLSDIYHDIICEQRLRRDEYLLNLLEKELREISKA
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)



TTGGGS

GGG






T

SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence QDSLISMYAKKRNHAWFDFFRNLALLKAGEIFRSFGEGCIYLDMDMILTGKLGTIYAPDGISMHVDRSVN
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S

TT

STTGGG



SS
TT

S



TT


 .........220.........230.........240.........250.........260.........270........
Sequence IENSAIIVNRSNHPALLEGLSFMHSKVDAHPYYDGLGKGVKKYFNFTPLHNYNHFCDFIEFNHPNIIM
Predicted secondary structure
































SS confidence



































































Known secondary structure (DSSP) SSTT
S
SS

TT

TT

TTS
B


TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D