Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5h3cB_

Fold library idPDB HeaderMoleculeTitle
c5h3cB_2.60PDB header: immune systemChain: B: PDB Molecule: protein suppressor of npr1-1, constitutive 1;


Added to library: Thu Feb 9 13:14:57 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RYDVFPSFRGEDVRDSFLSHLLKELRGKAITFIDDLSAIKESRIAIVIFSKNYASSTWCLNELVEIHKCY
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)


TTTTT






TTGGG
TTGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence TNLNQXVIPIFFHVDASEVKKQTGEFGKVFEETEKQSWKQALAAVAVXAGYDLRKWPSEAAXIEELAEDV
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)

SSS


TT

TSS
GGGSS
 .....
Sequence LRKTX
Predicted secondary structure

SS confidence




Known secondary structure (DSSP) TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D