Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5h3bA_

Fold library idPDB HeaderMoleculeTitle
c5h3bA_1.49PDB header: hydrolaseChain: A: PDB Molecule: uncharacterized protein hi_1552;


Added to library: Thu Feb 9 13:59:38 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XKTKFYDYQGEHLILYFAGWGTPPDAVNHLILPENHDLLICYDYQDLNLDFDLSAYRHIRLVAWSXGVWV
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)




S

TT

GGGGTTSB

TT

SS






TT
S
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AERVLQGIRLKSATAVNGTGLPCDDSFGIPYAIFKGTLENLTENTRLKFERRICGDKASFERYQLFPARP
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTT


SS

S
SB
TTTSB
T


STTS



 .........150.........160.........170.........180.........190.........200.........210
Sequence FDEIHQELTALFAXIQQDKRIDLIHWANAWVSSRDKIFTPANQHQYWALRCAVQEIEGEHYVFSRFTHWS
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)




SS

STT
SSS
TTTSSS
S

GGG
SBGG
 ....
Sequence ALWD
Predicted secondary structure
SS confidence



Known secondary structure (DSSP) GGT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D