Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5h1qC_

Fold library idPDB HeaderMoleculeTitle
c5h1qC_3.30PDB header: transport proteinChain: C: PDB Molecule: innexin-6;


Added to library: Thu Feb 9 14:15:32 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AINSVNALISRVFVQPKGDLADRLNSRVTVVILAVSSALLLSSHFDPITCWTPAQFNAQWVNFVNQYCFV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)




STSS




-
TTTTT





TT

STT
 .........80.........90.........100.........110.........120.........130.........140
Sequence HGTYFVPLDQQLAFEEEERTKVSIQYYQWVPYVFALQAFLFYIPRFIWKAMIAYSGYDLAAAVKYVDRFW
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) S

B


SSSTT
STTTTTTSS



TTTS

 .........150.........160.........170.........180.........190.........200.........210
Sequence SENRDKDDKFKTRLAAFEGRPSVYIWDGIRLARKKRSRNMALFYTLSTVWQAVNAWIQFYILTQLLDSSI
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TTT
TTSSTTTTT
S

SBTTB
 .........220.........230.........240.........250.........260.........270.........280
Sequence YTLWGPSILGDLLQGNDWQTTGHFPRIVHCDFNRRRPASVQLDTVLCVLTLNIYYEKLFIFLWFWLVFVA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)



TTT
TTTTTSSS
SB


SSS




ST
 .........290.........300.........310.........320.........330.........340.........350
Sequence VVSTVNCFKWIYYLCNKTKAQKTIKNYLSTAPIKSTISDDQFFSALGEDGLFIMDQMALNLGDIPASYLT
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
SSSSTTT
TT

S

STTTT
S
 .........360.
Sequence ISMRNICQDFI
Predicted secondary structure

SS confidence










Known secondary structure (DSSP) S
STT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D