Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5gziB_

Fold library idPDB HeaderMoleculeTitle
c5gziB_2.17PDB header: lyaseChain: B: PDB Molecule: lysine cyclodeaminase;


Added to library: Sat Jan 20 10:58:34 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence METWVLGRRDVAEVVAAVGRDELMRRIIDRLTGGLAEIGRGERHLSPLRGGLERSEPVPGIWEWMPHREP
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)



TTSS






SSS
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence GDHITLKTVGYSPANPARFGLPTILGTVARYDDTTGALTALMDGVLLTALRTGAASAVASRLLARPDSHT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT
TTS

STTT

SS
TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence LGLIGTGAQAVTQLHALSLVLPLQRALVWDTDPAHRESFARRAAFTGVSVEIAEPARIAAEADVISTATS
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)

SS



SSTGGG




S


 .........220.........230.........240.........250.........260.........270.........280
Sequence VAVGQGPVLPDTGVREHLHINAVGADLVGKTELPLGLLERAFVTADHPEQALREGECQQLSADRLGPQLA
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

TT


SS
SS


TT




STT


S
TSSSSGGGGS
GGG



 .........290.........300.........310.........320.........330.........340......
Sequence HLCADPAAAAGRQDTLSVFDSTGFAFEDALAMEVFLEAAAERDLGIRVGIEHHPGDALDPYALQPL
Predicted secondary structure




































SS confidence

































































Known secondary structure (DSSP)
GGGGTTGGGS




TT
S

S


SSTT
TT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D