Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5guhA_

Fold library idPDB HeaderMoleculeTitle
c5guhA_2.40PDB header: hydrolase/rnaChain: A: PDB Molecule: piwi;


Added to library: Thu Feb 9 15:14:23 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ISILRTRPEAVTSKKGTSGTPLDLLANYFTVETTPKWGLYQYHVDISPEEDSTGVRKALMRVHSKTLGGY
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
B



S
TT
S





SS
SS

TT



TT
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence LFDGTVLYTVNRLHPDPMELYSDRKTDNERMRILIKLTCEVSPGDYHYIQIFNIIIRKCFNLLKLQLMGR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SSSSS

SSTT


SSS



TTBTT
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence DYFDPEAKIDIPEFKLQIWPGYKTTINQYEDRLLLVTEIAHKVLRMDTVLQMLSEYAATKKIFLEDVVGK
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
GGG
GGGT
SSS

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence IVMTDYNKRTYRVDDVANVSPKSTFKMRDENITYIEYYYKKYNLRIQDPGQPLLISRSKPREIRAGLPEL
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TTTT





TTSTTT



S
TT



SS
SSSS

 .........290.........300.........310.........320.........330.........340.........350
Sequence IYLVPELCRQTGLSDEMRANFKLMRSLDVHTKIGPDKRIEKLNNFNRRFTSTPEVVEELATWSLKLSKEL
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
GGGS





T
TTT
SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence VKIKGRQLPPENIIQANNVKYPAGDTTEGWTRDMRSKHLLAIAQLNSWVVITPERQRRDTESFIDLIIKT
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)




GGG



STTTTTT


SB


B

STT
 .........430.........440.........450.........460.........470.........480.........490
Sequence GGGVGFRMRSPDLVVIRHDGPIEYANMCEEVIARKNPALILCVLARNYADRYEAIKKKCTVDRAVPTQVV
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT

B


S


S

SSS

TSS


 .........500.........510.........520.........530.........540.........550.........560
Sequence CARNMSSKSAMSIATKVAIQINCKLGGSPWTVDIPLPSLMVVGYDVCHDTRSKEKSFGAFVATLDKQMTQ
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) SSTTTT
BS
B




TT
SSSTT

STT


 .........570.........580.........590.........600.........610.........620.........630
Sequence YYSIVNAHLSSHMGFNIASAVKKFREKNGTYPARIFIYRDGVGDGQIPYVHSHEVAEIKKKLAEIYAGVE
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)

SS

SS

GGGTTTS
 .........640.........650.........660.........670.........680.........690.........700
Sequence IKLAFIIVSKRINTRIFVQRGRSGENPRPGTVIDDVVTLPERYDFYLVSQNVREGTIAPTSYNVIEDTTG
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

S




TT


TT
SSSS
TTS





SSS




S
 .........710.........720.........730.........740.........750.........
Sequence LNPDRIQRLTYKLTHLYFNCSSQVRVPSVCQYAHKLAFLAANSLHNQPHYSLNETLYFL
Predicted secondary structure

















SS confidence


























































Known secondary structure (DSSP)

TT

TT
SS

SS
TT
S


GGGTTS
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D