Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5gsnD_

Fold library idPDB HeaderMoleculeTitle
c5gsnD_2.20PDB header: flavoproteinChain: D: PDB Molecule: flavin-containing monooxygenase;


Added to library: Thu Feb 9 21:23:54 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TKRVAVIGAGPSGLAQLRAFQSAADQGAEIPEIVCFEKQANWGGLWNYTWRTGLDENGEPVHCSMYRYLW
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)



ST




SSSSS
GGGS

S

SB
TTSSB





TT
B
 .........80.........90.........100.........110.........120.........130.........140
Sequence SNGPKEGLEFADYSFEEHFGKQIASYPPRAVLFDYIEGRVHKADVRKWIRFNSPVRWVSYDAETAKFTVT
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
SS
GGGG

SS

SS


SS
BT
GGG
S

TTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence AHNHETDSTYSAAFDHVICASGHFSTPNVPFYEGFDTFNGRIVHAHDFRDAREFEGKDVLVMGASSSAED
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTTTS


SSSSB




TTTTT
SSGGG


GGGGBT

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence IGSQCWKYGAKSITSCYRSAPMGYAWPDNWEEKPALEKLTGKTAHFADGSTRDVDAIILCTGYKHFFSFL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TTBS
SSS






TT

TTTTS

S


B



TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence PDDLRLKTANRLATADLYKGVAYVHNPAMFYLGMQDQWFTFNMFDAQAWWVRDAILGRITLPKDKAAMLA
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
GGG




SSSS
TTTTTTT
TT
S
S

SS
TSS


S
 .........360.........370.........380.........390.........400.........410.........420
Sequence DVAERETREEASDDVKYAIRYQADYVKELVAETDYPSFDIDGACDAFFEWKKHKAKDIMAFRDNSYKSVI
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) T


TTSS





TTTTTS


B
SS
 .........430.........440.....
Sequence TGTMAPVHHTPWKEALDDSMEAYLQ
Predicted secondary structure














SS confidence
























Known secondary structure (DSSP) S

B



SS
TTT




S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D