Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5gs2H_

Fold library idPDB HeaderMoleculeTitle
c5gs2H_3.59PDB header: sugar binding protein/immune systemChain: H: PDB Molecule: anti-mbp;


Added to library: Thu Feb 9 16:16:00 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VQLVESGGGLVQPGGSLRLSCAASGFNFSSSSIHWVRQAPGKGLEWVASISSSSGSTSYADSVKGRFTIS
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)



TT

SS
STTS
TTS
TTT


GGGTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence ADTSKNTAYLQMNSLTAEDTAVYYCARYGHWSWGRWWNYWVALDYWGQGTLVTVSSDIVMTQSQKFMSTS
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTTT
S

GGG


SSTTSS
TTSS












S
SB



 .........150.........160.........170.........180.........190.........200.........210
Sequence AGDRVSITCKASQNVRTAVAWYQQKPGQSPKALIYLASNRHTGVPDRFTGSGSGTDFTLTISNVQSEDLA
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) SS



S

TTS


SSS
B
TT

TT
S

GGG
S
 .........220.........230.
Sequence DYFCLQHWSYPYTFGGGTKLE
Predicted secondary structure





SS confidence




















Known secondary structure (DSSP)
SSSS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D