Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5gr8A_

Fold library idPDB HeaderMoleculeTitle
c5gr8A_2.59PDB header: transferaseChain: A: PDB Molecule: leucine-rich repeat receptor-like protein kinase pepr1;


Added to library: Thu Feb 9 14:40:32 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LNSDGLTLLSLLKHLDRVPPQVTSTWKINASEATPCNWFGITCDDSKNVASLNFTRSRVSGQLGPEIGEL
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)

TT

SS

TT


STTSTT
TTSS
TTS




GGGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence KSLQILDLSTNNFSGTIPSTLGNCTKLATLDLSENGFSDKIPDTLDSLKRLEVLYLYINFLTGELPESLF
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) TT



SS
SB

GGGGG
TT



SS




TTGGG
SS



SS


GGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence RIPKLQVLYLDYNNLTGPIPQSIGDAKELVELSMYANQFSGNIPESIGNSSSLQILYLHRNKLVGSLPES
Predicted secondary structure
































































SS confidence





































































Known secondary structure (DSSP) G
TT



SS


GGGGG
SS



SS

GGGGG
TT



SSS


GG
 .........220.........230.........240.........250.........260.........270.........280
Sequence LNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTLDLSYNEFEGGVPPALGNCSSLDALVIVSGNLSGTIP
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) GGG
TT



SS


S




SSS
TT



SS

SS


GGGGG
TT



SS




 .........290.........300.........310.........320.........330.........340.........350
Sequence SSLGMLKNLTILNLSENRLSGSIPAELGNCSSLNLLKLNDNQLVGGIPSALGKLRKLESLELFENRFSGE
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) GGGGG
SS



SS
S


GGGGG
TT



SS




GGGGG
TT



SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence IPIEIWKSQSLTQLLVYQNNLTGELPVEMTEMKKLKIATLFNNSFYGAIPPGLGVNSSLEEVDFIGNKLT
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)

T
SS
S

SS

GGGGG
TT



SS

TTTTSS





SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence GEIPPNLCHGRKLRILNLGSNLLHGTIPASIGHCKTIRRFILRENNLSGLLPEFSQDHSLSFLDFNSNNF
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) S


TTTTTTS




SSS




TT
S

SS





TT





SS
 .........500.........510.........520.........530.........540.........550.........560
Sequence EGPIPGSLGSCKNLSSINLSRNRFTGQIPPQLGNLQNLGYMNLSRNLLEGSLPAQLSNCVSLERFDVGFN
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)

GGGGG
TT



SS


GGGGG
SS



SS


GGGGG
TT
S

SS
 .........570.........580.........590.........600.........610.........620.........630
Sequence SLNGSVPSNFSNWKGLTTLVLSENRFSGGIPQFLPELKKLSTLQIARNAFGGEIPSSIGLIEDLIYDLDL
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
SB

GGGGG
TT



SS

BSSS
S
GGG
TT



SS


S


GGGG

TT

S
 .........640.........650.........660.........670.........680.........690.........700
Sequence SGNGLTGEIPAKLGDLIKLTRLNISNNNLTGSLSVLKGLTSLLHVDVSNNQFTGPIPDNLEGQLLSEPSS
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) TTS




GGGGG
SS



SS
S
SGGGGG
TT



S



S


TT


GGG
 .........710
Sequence FSGNPNLCIP
Predicted secondary structure








SS confidence









Known secondary structure (DSSP) G
S
TT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D