Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5gmkq_

Fold library idPDB HeaderMoleculeTitle
c5gmkq_3.40PDB header: rna binding protein/rnaChain: Q: PDB Molecule: pre-mrna-splicing factor slt11;


Added to library: Thu Feb 9 17:14:55 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPSAQQASSIPNLLTSL
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)


SSS



SS
SSS

SSS
TTT




TTTSB
S


SSS



 .........80.........90.........100.........110.........120.........130.........140
Sequence QNEWDAIMLENFKLRSTLDSLTKKLSTVMYERDAAKLVAAQLLMEKNEDSKDLPKSSQQDFVARGKLKAP
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)



SS
SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence KWPILKNLELLQKTFPYKEKWVCMCRCEDGALHFTQLKTITTITTPNPRTGGEHPARLLLLYPSKTNKVL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)


TT



TTTT



SSSS










 .........220.........230.........240.........250.........260.........270.........280
Sequence REMYGHNEVNTEYFIWADNRGTIGFYIVHSAKSDVEYSSGVLHKDSLLLALYSPDGILDVYNLSSPDQAS
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)


TTSS

TTS


TTT
S



TTSS
TTS
TTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence SRFPAKIKEVKFADNGYWMVVECQTVVCFDLRKDVGTLAYPTYKTGTVTYDIDMIAYSNESNSLTIYKFD
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)






TTSS

TTTT







SSTT
 .........360.........370.........380.......
Sequence KKKNWTKDEESALCLQSDTADFTDMDVVCGDAILKTN
Predicted secondary structure
















SS confidence




































Known secondary structure (DSSP) T




SSS

GGGS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D